PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK01104.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 151aa    MW: 17494.7 Da    PI: 10.086
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK01104.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.86.3e-5121321128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                + pGfrFhPtdeelv +y ++k+++++l+l    ik+vdiyk++PwdLp    +++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++++s+ ++
  PK01104.2   2 MLPGFRFHPTDEELVGFYPNRKIQQHPLPLPIElIKQVDIYKYDPWDLPnLGSSTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYSSdGT 101
                579************************7764444***************556677999**************************************9566 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                + +glkk+Lvfy+gra kg ktdW+mhe+rl
  PK01104.2 102 KCIGLKKSLVFYRGRAAKGMKTDWMMHEFRL 132
                67***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-532136IPR003441NAC domain
PROSITE profilePS5100551.8252151IPR003441NAC domain
PfamPF023658.7E-254132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
XMLPGFRFHP TDEELVGFYP NRKIQQHPLP LPIELIKQVD IYKYDPWDLP NLGSSTGEKE  60
WYFYCPRDRK YRNSARPNRV TGAGFWKATG TDRPIYSSDG TKCIGLKKSL VFYRGRAAKG  120
MKTDWMMHEF RLPSLTDSTT TTTPSPSKNH K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-48413217140Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010029299.16e-86PREDICTED: protein FEZ
RefseqXP_011468662.12e-86PREDICTED: protein FEZ-like
SwissprotQ9FIW54e-80NAC94_ARATH; Putative NAC domain-containing protein 94
TrEMBLA0A059ARZ06e-86A0A059ARZ0_EUCGR; Uncharacterized protein
TrEMBLA0A0M4FSH58e-86A0A0M4FSH5_MANES; NAC transcription factors 66
TrEMBLB2ZGS14e-86B2ZGS1_SOYBN; NAC domain protein (Fragment)
STRINGVIT_14s0108g00860.t012e-84(Vitis vinifera)
STRINGPOPTR_0017s11830.15e-84(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-77NAC family protein